Protein Info for PGA1_c31500 in Phaeobacter inhibens DSM 17395

Annotation: Protein of unknown function (DUF3095).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF11294: DUF3095" amino acids 6 to 376 (371 residues), 443.1 bits, see alignment E=4.7e-137

Best Hits

KEGG orthology group: None (inferred from 56% identity to sit:TM1040_3458)

Predicted SEED Role

"Adenylyl cyclase CyaC (EC 4.6.1.1)" (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0S0 at UniProt or InterPro

Protein Sequence (384 amino acids)

>PGA1_c31500 Protein of unknown function (DUF3095). (Phaeobacter inhibens DSM 17395)
MTQDGFYQSLSPSRDFAGLTRAGAFTPLPRDWMVGCCDIVNSTDLIASGRYKTVNTIGAS
VIAAMINALQGVPFPYVFGGDGASFAVGPEHADIARDTLARLRSWASAEFDIDLRAALLP
VSWIRAEGLDVAVARYAVSEAADYAMFAGGGLNWAERQMKLGGFEVPPAPLPDPPDLTGL
SCRWNTIPARNGLILSVVVQPEPTASAKDFAKIAGDILAVADKLQRNGHPVPEGGPSFSF
PPPGLTLEAKISRGKTALILRKAQLFIQTTLAAYALSRKRPLGSFDAQHYRRMLVANADF
RKFDDGLKLTLDCPPQVRDDITRILEKAATAGHARYGLHEQDEALVTCIVPSVMRDDHVH
FIDGASGGYTQAALRMAASDRATA