Protein Info for HP15_3033 in Marinobacter adhaerens HP15

Annotation: amino acid ABC transporter, inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 22 to 126 (105 residues), 75.2 bits, see alignment E=2.4e-25 PF00528: BPD_transp_1" amino acids 39 to 228 (190 residues), 71.6 bits, see alignment E=3.7e-24

Best Hits

Swiss-Prot: 47% identical to HISM_ECOL6: Histidine transport system permease protein HisM (hisM) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 92% identity to maq:Maqu_3310)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNW7 at UniProt or InterPro

Protein Sequence (240 amino acids)

>HP15_3033 amino acid ABC transporter, inner membrane subunit (Marinobacter adhaerens HP15)
MPDFIAEWLNQNEIFTAMTIMEYWDGMVTTVHLVFLSLVIGLLVAVPLAILRTVRNPFVS
GPVWLYTYLFRGTPLLIQLYIIYYGLAQIEGIQETFWWEIFREPFYPALLAFTLNTAAYT
TEIIRGAIISTPNGEIEAAKAYGMNWFMRMRRIVLPSAARRAVQAYSNEVIFMLHASAIA
SVVTIVDLTGAARNIYSRFYAPFDAFIFVALCYMALTFILVFAFRKLETHLLKHQRPVNG