Protein Info for HP15_3031 in Marinobacter adhaerens HP15

Updated annotation (from data): L-arginine ABC transporter, periplasmic substrate-binding component ArtJ/HisJ/ArtI/AotJ/ArgT
Rationale: Specifically important for utilization of arginine as a nitrogen source.
Original annotation: extracellular solute-binding protein, family 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00497: SBP_bac_3" amino acids 26 to 245 (220 residues), 138.6 bits, see alignment E=1.1e-44 PF10613: Lig_chan-Glu_bd" amino acids 70 to 110 (41 residues), 34.2 bits, see alignment 2.4e-12

Best Hits

KEGG orthology group: None (inferred from 87% identity to maq:Maqu_3308)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNW5 at UniProt or InterPro

Protein Sequence (250 amino acids)

>HP15_3031 L-arginine ABC transporter, periplasmic substrate-binding component ArtJ/HisJ/ArtI/AotJ/ArgT (Marinobacter adhaerens HP15)
MKKMIFAASCALALIAGGAQAQERDLRIAFDVPYEPFEYKDENGELTGFEVELAEAMCEE
MNANCEFVIQAWDGMIPGLLARKFDLIMSSMSITPERAERVLFSEPYYNTPGGWFGPESF
NTDVTDMSAMEGKTVGVQRGTTMDTYVTENMGGIVTIKRYTTADDMVLDLEGQRLDVVFV
DYPVGEQTVLTKEGFKEVGEAVKLGEGVGVAMRQRDTDLAEEVNAALRTLKEDGTYDTIM
QKYFAYDIKM