Protein Info for PGA1_c31370 in Phaeobacter inhibens DSM 17395

Annotation: homoprotocatechuate degradative operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 TIGR02337: homoprotocatechuate degradation operon regulator, HpaR" amino acids 11 to 139 (129 residues), 135.3 bits, see alignment E=5.6e-44 PF22381: Staph_reg_Sar_Rot" amino acids 31 to 108 (78 residues), 30.3 bits, see alignment E=9e-11 PF12802: MarR_2" amino acids 35 to 93 (59 residues), 44.2 bits, see alignment E=4.6e-15 PF01047: MarR" amino acids 36 to 92 (57 residues), 55.2 bits, see alignment E=1.3e-18 PF13412: HTH_24" amino acids 37 to 83 (47 residues), 25.5 bits, see alignment E=2e-09

Best Hits

KEGG orthology group: None (inferred from 70% identity to sit:TM1040_3470)

Predicted SEED Role

"Homoprotocatechuate degradative operon repressor" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4T9 at UniProt or InterPro

Protein Sequence (144 amino acids)

>PGA1_c31370 homoprotocatechuate degradative operon repressor (Phaeobacter inhibens DSM 17395)
MTKQLPSTDRSLPIALLRARERVMGPIRALLSDAGLTEQQWRVLRVVQETGGIDPTQISE
RACLLLPSLTRILQKLEDKGLIQRTKDQIDRRRQIVSITSAGAQVIDDNLEASLAVIART
RTQMGEDRYEALLDLLNELHQLDE