Protein Info for HP15_3029 in Marinobacter adhaerens HP15

Annotation: GntR domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00392: GntR" amino acids 4 to 66 (63 residues), 68.7 bits, see alignment E=2.8e-23 PF07729: FCD" amino acids 95 to 218 (124 residues), 84.5 bits, see alignment E=8.5e-28

Best Hits

Swiss-Prot: 43% identical to GLCC_ECOLI: Glc operon transcriptional activator (glcC) from Escherichia coli (strain K12)

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 74% identity to maq:Maqu_3306)

Predicted SEED Role

"Glycolate utilization operon transcriptional activator GlcC" in subsystem Glycolate, glyoxylate interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNW3 at UniProt or InterPro

Protein Sequence (252 amino acids)

>HP15_3029 GntR domain protein (Marinobacter adhaerens HP15)
MAISQEISYRLERLILDGGLAPEQKIPSERQLATRLGVSRAVIREALHELQGRGVIETRH
GKGSFVASMVPGASELGEQSPLMHLFEGHPRTLFDLLEVREQLEGQAAYLAALRATRLDR
HRITKAFRALEDTDPLRNARLDHGFHLAIVEASHNPVLVHVLNSLKNMMLLTVQASVANL
NPREEMRKKIVRQHRQLYEAVIAGKPANAQKVAMAHVRFVSEAMRDMEKDGGKLIRLPIE
QDKANDHLRAEA