Protein Info for HP15_3028 in Marinobacter adhaerens HP15

Updated annotation (from data): TRAP-type D-lactate transporter, periplasmic component
Rationale: Specific phenotype: utilization of D-Lactate. (The mutant is possibly polar on D-lactate oxidase HP15_3024, but role is confirmed by similarity to Q5SK82)
Original annotation: TRAP dicarboxylate family transporter, DctP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF03480: DctP" amino acids 75 to 363 (289 residues), 144.9 bits, see alignment E=1.7e-46

Best Hits

Swiss-Prot: 54% identical to TLBP_THET8: Lactate-binding periplasmic protein TTHA0766 (TTHA0766) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: None (inferred from 56% identity to rde:RD1_3770)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNW2 at UniProt or InterPro

Protein Sequence (396 amino acids)

>HP15_3028 TRAP-type D-lactate transporter, periplasmic component (Marinobacter adhaerens HP15)
MSACAGVAIDADKNKANGDVSMNSKNNIRNSCDTGETPPRRSFLKTIAMGATLAGAMLMG
AGQAQAATTWKIQSTWDAGTVGYTLFEEWCKSIEAKSGGELKFQCFPAKAVAADNNALFD
AVRNGVLQGMNPFTLYWAGKIPASVFLSSYPAGPDQPHQWDTMFYSMGMLEKTREIYKKF
GLFYVGPIQHDANIIHSKQPVNSLDDLKGMKIRVPGGMVAEVFQQFGVSTVSLPGSDIFP
ALEKGTIDAADFVGPAVNYELGFSQVTDYIIFGPPGVMSIYQPVDLMDLTVSLRAWNSIS
PELQQLVEDEVRIYSQKHYLAIQARNIEAMEKFKADGDTVTRLSQEDLETWRKAAIPIWF
NWANKNDDARAILDIQLKYMMNDTVGYITEEDIKGF