Protein Info for PGA1_c31340 in Phaeobacter inhibens DSM 17395

Annotation: HTH-type transcriptional regulator, DeoR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF01047: MarR" amino acids 8 to 58 (51 residues), 28 bits, see alignment 7.4e-10 PF12802: MarR_2" amino acids 8 to 57 (50 residues), 28.9 bits, see alignment 4.7e-10 PF13412: HTH_24" amino acids 8 to 55 (48 residues), 22 bits, see alignment 4.3e-08 PF08279: HTH_11" amino acids 10 to 52 (43 residues), 26.1 bits, see alignment 2.9e-09 PF08220: HTH_DeoR" amino acids 11 to 62 (52 residues), 41.8 bits, see alignment 3.3e-14 PF01022: HTH_5" amino acids 12 to 55 (44 residues), 24.1 bits, see alignment 1.2e-08 PF09339: HTH_IclR" amino acids 12 to 57 (46 residues), 22.1 bits, see alignment 4.6e-08 PF00455: DeoRC" amino acids 80 to 236 (157 residues), 128.9 bits, see alignment E=8.4e-41

Best Hits

KEGG orthology group: K02444, DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor (inferred from 36% identity to cse:Cseg_2454)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUP9 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PGA1_c31340 HTH-type transcriptional regulator, DeoR family (Phaeobacter inhibens DSM 17395)
MPADQKMSHRELELLEALRRLGGSARSGELAKVLGVSEETVRRTIKALAKQGLVQRVHGG
AYLSGPDTADSFCRRISKYTEEKQSIAAGVLPQITDGMAIFLDVGSTTAFVAKELRCRAN
LTVVTNSIGVAQTLANHNGNRVHFLGGEIQSNERGTFGHVAEQQVRAFALDLAVLSADAF
SAKHGALYHSATEAQLAAVVAQAAERTLLILAHPKFDDMAPHRGPQPEMLDLLMTDVLPG
RKYRRALETWGIGLELAPTQDAEAASEVKAKKRASLLE