Protein Info for Psest_3140 in Pseudomonas stutzeri RCH2

Annotation: NTP pyrophosphohydrolases including oxidative damage repair enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 202 to 219 (18 residues), see Phobius details PF00293: NUDIX" amino acids 62 to 143 (82 residues), 44.1 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_1184)

Predicted SEED Role

"Hypothetical nudix hydrolase YeaB" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNQ8 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Psest_3140 NTP pyrophosphohydrolases including oxidative damage repair enzymes (Pseudomonas stutzeri RCH2)
MDIQAIRSSGSIGYFEALGRCAFHAMMPVKDETRKFMLDKILHRVRAYSPHLLEPEDRLP
EAAVLMPITRSESPELVLTLRAAGLSTHGGEVAFPGGRRDPEDRDLLHTALREAEEEVGL
APGMVEVVGPLSSLVSVHGIHVTPYVGLVPDYVEYRANDAEIASVFSVPLEFFCEDPREV
THRIDYQGQSWYIPSYRYGEYQIWGLTAIMIVELVNVIYDAGIEMRRAPAAFIDLSGRSE
P