Protein Info for Psest_0309 in Pseudomonas stutzeri RCH2

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 359 (323 residues), 271.8 bits, see alignment E=3.5e-85 PF25917: BSH_RND" amino acids 61 to 190 (130 residues), 94 bits, see alignment E=1e-30 PF25876: HH_MFP_RND" amino acids 97 to 157 (61 residues), 34.5 bits, see alignment E=4.9e-12 PF25944: Beta-barrel_RND" amino acids 194 to 282 (89 residues), 93.3 bits, see alignment E=2.5e-30 PF25967: RND-MFP_C" amino acids 289 to 349 (61 residues), 76.2 bits, see alignment E=3.8e-25

Best Hits

Swiss-Prot: 66% identical to MEPA_PSEPU: Multidrug/solvent efflux pump periplasmic linker protein MepA (mepA) from Pseudomonas putida

KEGG orthology group: K03585, membrane fusion protein (inferred from 94% identity to psa:PST_3940)

MetaCyc: 54% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHM7 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psest_0309 RND family efflux transporter, MFP subunit (Pseudomonas stutzeri RCH2)
MPIKSANAALMSILAMAVFLAGCQEEAAPPAQQKPKVGIVTLQAEPFAVTTELPGRTRAY
RIAEVRPQVNGIIQKRLFTEGSDVKAGQQLYQIDASVYEATLKSAQASVASSKSLADRYA
ELVKDQAVSKQAYDEARAASLQAEAELERARIDVRYTKVLAPISGRVGRSAVTEGALVSN
GQAQELATIQQLDPIYVDVTQPARDLLALRRDLAEGRLQKSGDNAAKVTLKLEDGSDYAH
EGKLEFSEVTVDAGTGSVTLRAVFPNPDKDLLPGMFVHAQLVAGMKSEAILVPQQGVTRN
TKGDPTAMVVNAESKVEVRPIKTERAVGNRWLVGEGLQPGDRVITEGLQFIQPGVEVEAV
PATNVDNRGGVPAQPQGQEG