Protein Info for Psest_3136 in Pseudomonas stutzeri RCH2

Annotation: Putative Mg2+ and Co2+ transporter CorB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 62 to 85 (24 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details PF01595: CNNM" amino acids 12 to 182 (171 residues), 196.5 bits, see alignment E=4.6e-62 PF00571: CBS" amino acids 204 to 262 (59 residues), 22.9 bits, see alignment E=1.3e-08 amino acids 277 to 325 (49 residues), 31.6 bits, see alignment 2.6e-11 PF03471: CorC_HlyC" amino acids 342 to 413 (72 residues), 65.2 bits, see alignment E=6.6e-22

Best Hits

Swiss-Prot: 48% identical to YFJD_ECOLI: UPF0053 inner membrane protein YfjD (yfjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to psa:PST_1188)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPB8 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Psest_3136 Putative Mg2+ and Co2+ transporter CorB (Pseudomonas stutzeri RCH2)
MENLHPGFLVGLLVFLLLCSAFFSSSETGMLSLNRYRLRHQAKEGHRGARRASELLAHPD
RLLGTILVGNNFVNILASSIATVLAMQLWGEAGIAIATIGLTIILLIFGEITPKTLAALR
PEIVAYPVSLPLKMLQKVLYPLVAMLSWVSNGLLKLLGVDLSNKGNDSLSTEELRSVVRE
SGSDLPLNRQSMLLGILDLERVTVDDIMIPRNEVTGIDLDDDLESIVSQLRTTPHTRLPV
FRNDINQIEGIVHMRQIARLLSHDQLTKDSLLAACSEPYFVPENTPLSTQLLNFQKQKRR
IGIVVDEYGDVRGVVTLEDILEEIVGEFSNQDALRSPDIHPQDDGTLVIDGAAYIREVNR
ALDWQLPCDGPKTLNGLITEALEHMPDAGICLQIGNYRLEILQAADNRVKSVRAWTIGDA
RAADQQAQ