Protein Info for PGA1_c31280 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 265 (174 residues), 47.3 bits, see alignment E=1.1e-16

Best Hits

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F325 at UniProt or InterPro

Protein Sequence (439 amino acids)

>PGA1_c31280 ABC transporter permease protein (Phaeobacter inhibens DSM 17395)
MKNLSFLRLSVWFYLAIFFAYLLGPLVIMSVTAFNSPGFPQATPWECLTFEWFSALFQDE
RILNGIKNSILVGAGTVVLSVAMGLAGALMLTQIWPKLRATYYTVIIAPILIPGVVIGIS
TLVFWDRINRMVGLGADSFLSNGLFLTIIGQSTFIASYCMLVLVARLQRYDMALTEAALD
LGATHAQAFRKVLLPFMKPAIASAAVLAFLASFENYNTTTFTFGEYPTLTIELAQKVRYG
ITPAISALAFIIVVLTVFAALFNEATIRRRELVAAARKDATVEELESGRLRLPGFLSSNW
AALGLVGVACFTIVIVGTATVYSPAQCIADVKEQKRLETEVRIQELRQRRADEAARRAAE
EAESGGSEAGGATSEPTTSGGNNSGFGGVFDPNALGGDAATSEGEDESSAPAPATGGNSA
FGGAFDPNALSGGSTSDGN