Protein Info for HP15_3015 in Marinobacter adhaerens HP15

Annotation: A/G-specific adenine glycosylase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01084: A/G-specific adenine glycosylase" amino acids 5 to 265 (261 residues), 370.6 bits, see alignment E=2.8e-115 PF00730: HhH-GPD" amino acids 34 to 167 (134 residues), 76 bits, see alignment E=5.5e-25 PF00633: HHH" amino acids 98 to 126 (29 residues), 25.9 bits, see alignment (E = 1.3e-09) PF10576: EndIII_4Fe-2S" amino acids 191 to 207 (17 residues), 20.1 bits, see alignment (E = 1.3e-07) PF14815: NUDIX_4" amino acids 234 to 347 (114 residues), 85 bits, see alignment E=6.7e-28

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 80% identity to maq:Maqu_3176)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNU9 at UniProt or InterPro

Protein Sequence (355 amino acids)

>HP15_3015 A/G-specific adenine glycosylase-like protein (Marinobacter adhaerens HP15)
MPDSFANKLLQWYDCHGRHDLPWHHNRNAYRVWVSEIMLQQTQVTTVIPYFEAFMKRFPD
VHALAEAPVDDVLSHWSGLGYYARARNLQKAAQTVVREFDGEFPQTQEKLESLTGIGRST
AAAILAQAFGIRAAILDGNVKRVLARYHAIPGWPGQTAVLNQLWQRAEEHTPKQRVRGYT
QGIMDLGAMVCTRSRPACESCPLQEGCRAYAQGETSLYPGSKPKKAKPEKSTWMVILEDG
EGRILLERRPPSGIWGGLWSLPELDPAYGADELQEACEQSLGLDCAEPELISGFRHTFSH
YHLHIQPARLNVTGGANTVADKDHLKWLHRHEALNLGLPAPIRSLLTEPEQAALL