Protein Info for Psest_0308 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04264: YceI" amino acids 25 to 187 (163 residues), 156.7 bits, see alignment E=2.9e-50

Best Hits

Swiss-Prot: 95% identical to Y3941_PSEU5: UPF0312 protein PST_3941 (PST_3941) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: None (inferred from 95% identity to psa:PST_3941)

Predicted SEED Role

"Protein yceI precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHX8 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Psest_0308 Uncharacterized conserved protein (Pseudomonas stutzeri RCH2)
MLKKTLAALVLGSALAGGQVFAADYAIDKEGQHAFVNFKISHLGYSWLWGTFKDFDGAFS
FDAAKPEESKVNVTLKTASVDTNHAERDKHLRSDDFLNVAKHPTATFESTSVKPTGDGTA
DIAGNLTLNGVTKPVVIAAKFIGEGKDPWGGYRAGFEGSTTLTLKDFDIKMDLGPASQTV
ELIISVEGVRK