Protein Info for HP15_3007 in Marinobacter adhaerens HP15

Annotation: carboxyl-terminal protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 80 to 396 (317 residues), 351.3 bits, see alignment E=2.5e-109 PF13180: PDZ_2" amino acids 126 to 206 (81 residues), 51.2 bits, see alignment E=2.6e-17 PF00595: PDZ" amino acids 126 to 194 (69 residues), 41.9 bits, see alignment E=2.1e-14 PF17820: PDZ_6" amino acids 143 to 195 (53 residues), 46.4 bits, see alignment 5.6e-16 PF03572: Peptidase_S41" amino acids 225 to 390 (166 residues), 199.1 bits, see alignment E=7.8e-63

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 83% identity to maq:Maqu_3168)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNU1 at UniProt or InterPro

Protein Sequence (468 amino acids)

>HP15_3007 carboxyl-terminal protease family protein (Marinobacter adhaerens HP15)
MKRVRSTLHALPLRSIALATCFATASGLVWAQDKDAATEQLLEGIQNGERVEISLPDPEK
QLPLEDLRKFTEVFSRIKDAYVEEVSDRKLLESAIKGMLSDLDPHSTYLAPKDYEELEES
TSGEFGGLGIEVGMENGFVKVIAPIDDTPAQKAGVQAGDLIIKLDEKPVKGMSLEEAVQL
MRGKPGSILTLTIMREGESAPIEIEVERDVIKVTSVKSRMLENGYGYVRITQFQADTGSQ
FKDALNGLEDELGRDLDGLVIDLRNNPGGVLQAAVETADALLDDGLIVYTEGRIQSSRLR
FSARSGDIMEGTPIVVLINGGSASASEILAGALQDHERAVVMGTKSFGKGSVQTVIPLDE
THAIKMTTARYYTPDGRSIQATGIKPDIEVRPAELKELDSKPFFTEADLSGHLEGQNEGQ
DQDGNDDAQNATGSLADRDYQLRSALNLLKGIRILNPNKSANAEGSDQ