Protein Info for PGA1_c31110 in Phaeobacter inhibens DSM 17395

Annotation: ribonuclease E/G family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10150: RNase_E_G
  • amino acids 101 to 197 (97 residues), 41.5 bits, E=5.5e-15
  • amino acids 209 to 330 (122 residues), 79.9 bits, E=1e-26

Best Hits

KEGG orthology group: K01128, [EC: 3.1.4.-] (inferred from 76% identity to sit:TM1040_3555)

Predicted SEED Role

"Ribonuclease, Rne/Rng family"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ether lipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.-

Use Curated BLAST to search for 3.1.4.-

Sequence Analysis Tools

See I7E4R7 at UniProt or InterPro

Protein Sequence (340 amino acids)

>PGA1_c31110 ribonuclease E/G family protein (Phaeobacter inhibens DSM 17395)
MKGRTIILDHIDGREAAALMVDGQLEDLLIDSDAPTPGTIYRARADRPVKGQGGMFLTTP
DGPAFLRQVKGLAPGQELLVQLTGYAEAGKALPVSQKLLFKSRYAIITPEAPGLNISRSI
RDEEERDRLLEIAHDAIGDSGYGLILRSACDGADSTDIEEDILAMVSLASQVLEDAGSGP
EVLAEGDTPHLLAWRDWTDPADIEREAGGFERLGVLDALETVRGIREPLSGGAFLFIEQT
RALVAVDVNTGADTSLAAGVKANMACAKSLARALRLRGLGGQIVVDPAPMPKKDRRAFET
ALRASFRSDSEDTVLVGWTTLGHFELQRKRGRIPLKEVLA