Protein Info for Psest_0307 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome B561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 13 to 40 (28 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 10 to 180 (171 residues), 113.4 bits, see alignment E=5.6e-37

Best Hits

Swiss-Prot: 56% identical to C56I_ECOLI: Cytochrome b561 homolog 2 (yceJ) from Escherichia coli (strain K12)

KEGG orthology group: K12262, cytochrome b561 (inferred from 87% identity to psa:PST_3942)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDU2 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Psest_0307 Cytochrome B561 (Pseudomonas stutzeri RCH2)
MRWRNSSTNYGLTSIALHWLVAAAVFGLFGLGYWMVGLTYYSSWYRTAPDLHKSIGLVLF
LIMLLRVLWRFISPAPAPLASQGRLTQMAAKLGHSVLYLGLFLVMMSGYLISTADGRAIS
VFGLFDVPALITSIPNQADSAGLVHEYAAWALVIFAVVHALAALKHHFIDRDATLKRMLG
RNPG