Protein Info for HP15_3002 in Marinobacter adhaerens HP15

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07715: Plug" amino acids 47 to 152 (106 residues), 90.6 bits, see alignment E=1.4e-29 PF00593: TonB_dep_Rec_b-barrel" amino acids 194 to 637 (444 residues), 177.5 bits, see alignment E=1.4e-55 PF14905: OMP_b-brl_3" amino acids 461 to 648 (188 residues), 47.8 bits, see alignment E=1.8e-16

Best Hits

Predicted SEED Role

"TonB-dependent hemin receptor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNT6 at UniProt or InterPro

Protein Sequence (669 amino acids)

>HP15_3002 TonB-dependent receptor (Marinobacter adhaerens HP15)
MYSRKSHLSLFCLSLAVLASGDAIADSQPTGYLNELVVTGTRSERKLLDTPVRTEVVTVE
ELEKTHARNLKEALENVPGLQLREIHGKPGYEVWLQGIESDRVLVLIDGMPMTATTGSTV
DVSQLAVLDIERVEVVKGAVSAQYGSSGIGGVVNIITRPPASGLSGQFTTDGGTYGEQNP
SGDEADPARYSARATVQGGSEQLALRLSASHQHSDGIDPEPDTWARPGDEYDRTDLSFRT
DWSPNANHQLSAAVARFEEESGSRFTERNPPFVINQGKDETVTRTRYTLAGDHGRNSDLR
AGWSAVHEVLNDDTLKYTGSGVFDDRRAESTLSRFSAHLGKPVGFTHHLQGGVDFNRETL
EQTKDGASELGAEPRRQRESQEAWVQDTWMPTEHLELVPGVRFQNDSDFGTYTAPKINAR
YDLVRTDSLTGFLRGGVGAGYRVPNLKERYFTFDHSQLGYIVQGTPDLQPEESVSYQFGG
GLSWNRTAWLEVNAFLNDIEQLIQTSPDAEATRARNDGVQVFSYENLAEARTWGFETTAG
WEPSQHWRLTAGYTLTRTEEVATGNELNRRPRHQARLGLDGPLLLAGLSWGARLRYQSEE
FVDAAAGTKSPGYTTADLKLNYQFSDQLRLFAGADNITDEQRDFSNASEDFRPVAGRFLY
AGLTVSFGE