Protein Info for Psest_3112 in Pseudomonas stutzeri RCH2

Annotation: electron transport complex, RnfABCDGE type, A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details TIGR01943: electron transport complex, RnfABCDGE type, A subunit" amino acids 3 to 192 (190 residues), 274.9 bits, see alignment E=2.8e-86 PF02508: Rnf-Nqr" amino acids 6 to 192 (187 residues), 205.4 bits, see alignment E=3.6e-65

Best Hits

Swiss-Prot: 98% identical to RNFA_PSEMY: Ion-translocating oxidoreductase complex subunit A (rnfA) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K03617, electron transport complex protein RnfA (inferred from 97% identity to pmk:MDS_1458)

MetaCyc: 55% identical to Rnf complex RnfA subunit (Acetobacterium woodii)
TRANS-RXN-276 [EC: 7.2.1.2]

Predicted SEED Role

"Electron transport complex protein RnfA" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLJ0 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Psest_3112 electron transport complex, RnfABCDGE type, A subunit (Pseudomonas stutzeri RCH2)
MTELALIMVSAILVNNFVLVQFLGLCPFMGVSKKIETAIGLSLATTFVLTLAAMCSYLVQ
QYVLKPLDLEFLRTISFILVIAVTVQFTEMVVNKTSPLLYRVLGIFLPLITTNCIVLGVA
LLNANKAEFTFLTATVNGFAAGLGFSLVLVLFAAMRERIAIADVPKSFQGAAIGMVTAGL
MSLAFMGFTGLIKL