Protein Info for Psest_3109 in Pseudomonas stutzeri RCH2
Annotation: Enoyl-CoA hydratase/carnithine racemase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 94% identity to psa:PST_1214)Predicted SEED Role
"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) / Enoyl-CoA hydratase [isoleucine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 4.2.1.17)
MetaCyc Pathways
- oleate β-oxidation (30/35 steps found)
- fatty acid salvage (6/6 steps found)
- adipate degradation (5/5 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- L-isoleucine degradation I (5/6 steps found)
- valproate β-oxidation (7/9 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
- adipate biosynthesis (4/5 steps found)
- fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- L-valine degradation I (6/8 steps found)
- fatty acid β-oxidation I (generic) (5/7 steps found)
- 2-methyl-branched fatty acid β-oxidation (10/14 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (7/10 steps found)
- propanoate fermentation to 2-methylbutanoate (4/6 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
- methyl ketone biosynthesis (engineered) (3/6 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- glycerol degradation to butanol (10/16 steps found)
- pyruvate fermentation to butanol I (4/8 steps found)
- benzoyl-CoA degradation I (aerobic) (3/7 steps found)
- pyruvate fermentation to butanoate (3/7 steps found)
- 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
- benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
- (8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- phenylacetate degradation I (aerobic) (3/9 steps found)
- 2-methylpropene degradation (2/8 steps found)
- superpathway of phenylethylamine degradation (4/11 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
- 3-phenylpropanoate degradation (3/10 steps found)
- methyl tert-butyl ether degradation (3/10 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
- L-glutamate degradation VII (to butanoate) (3/12 steps found)
- (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
- L-tryptophan degradation III (eukaryotic) (3/15 steps found)
- docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
- toluene degradation VI (anaerobic) (4/18 steps found)
- platensimycin biosynthesis (6/26 steps found)
- Spodoptera littoralis pheromone biosynthesis (3/22 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Caprolactam degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Limonene and pinene degradation
- Lysine degradation
- Propanoate metabolism
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
- alpha-Linolenic acid metabolism
- beta-Alanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.17
Use Curated BLAST to search for 4.2.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GQD8 at UniProt or InterPro
Protein Sequence (272 amino acids)
>Psest_3109 Enoyl-CoA hydratase/carnithine racemase (Pseudomonas stutzeri RCH2) MSTAVEPYQSGVFDLTHKLTVEKHGHTALITINHPPANTWDRESLIGLKQVVEHLNHDDD IYALVISGQGEKFFSAGADLKLFADGDRNRAREMARRFGEAFEALRDFRGVSIAAINGFA LGGGLECALACDLRIAEQQAQMGLPEASVGLLPCAGGTQALAWLVGEGWAKRMILCGERI TAETALRIGLIEQVVEPGQARGHALLLAARIARQSPVAVRAIKPLIDGARQRLPHTFGAA EREAFVELFEAEDTLEGVNAFLEKRDPRWRNR