Protein Info for HP15_2995 in Marinobacter adhaerens HP15

Annotation: short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 188 (182 residues), 144.3 bits, E=4.9e-46
• PF08659: KR
  • amino acids 8 to 118 (111 residues), 36.3 bits, E=8.2e-13
• PF13561: adh_short_C2
  • amino acids 12 to 243 (232 residues), 176.7 bits, E=9.4e-56

Best Hits

KEGG orthology group: K03793, pteridine reductase [EC: 1.5.1.33] (inferred from 73% identity to maq:Maqu_3161)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• folate transformations II (plants) (9/11 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• superpathway of chorismate metabolism (41/59 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33

Sequence Analysis Tools

See E4PNC6 at UniProt or InterPro

Protein Sequence (248 amino acids)

>HP15_2995 short-chain dehydrogenase/reductase SDR (Marinobacter adhaerens HP15)
MPSTTPVALITGAAHRLGAQTARTLHERGWNLVIHYRSREEQANSLIAQMNRERPDSACA
LRADLSQLAGVDQLASDAVAQWGRLDALVNNASVFYPTPTADATEDDWDTILNTNLRAPF
FLLQKCLAELRRNRGSVVNLIDIYSERPIDDHPLYCATKAGLAALTRSWAKDLAPDVRVN
GVSPGAILWPEGEAEMDQSAQQAILQKTPLARTGNPDDISKTIAFLICDAPFITGQIISV
DGGRSLNM