Protein Info for HP15_2989 in Marinobacter adhaerens HP15

Annotation: metal-sulfur cluster biosynthetic enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 TIGR03406: probable FeS assembly SUF system protein SufT" amino acids 7 to 179 (173 residues), 251.5 bits, see alignment E=1.9e-79 PF01883: FeS_assembly_P" amino acids 81 to 156 (76 residues), 57 bits, see alignment E=9.6e-20

Best Hits

KEGG orthology group: None (inferred from 91% identity to maq:Maqu_3156)

Predicted SEED Role

"probably aromatic ring hydroxylating enzyme, evidenced by COGnitor; PaaD-like protein (DUF59) involved in Fe-S cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNC0 at UniProt or InterPro

Protein Sequence (180 amino acids)

>HP15_2989 metal-sulfur cluster biosynthetic enzyme (Marinobacter adhaerens HP15)
MQEREVVLTKREVEARLVPSGTEIMIPSDTFVTITQSLGGTFTVAVNGNLARIEGHNADA
LGKKPLESSFETPEDGTVNENQVWEAMQNCYDPEIPVNVVDLGLIYECRIENGTEDGNHV
YVLMTLTAAGCGMGPVITEDVKTKLEHVPNVDKVTVELTFDPPWSNEMLTDEAKLELGML