Protein Info for HP15_2979 in Marinobacter adhaerens HP15

Annotation: NnrS family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details PF05940: NnrS" amino acids 18 to 388 (371 residues), 314 bits, see alignment E=9.3e-98

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 80% identity to maq:Maqu_3145)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNB0 at UniProt or InterPro

Protein Sequence (394 amino acids)

>HP15_2979 NnrS family protein (Marinobacter adhaerens HP15)
MRAIPTSPERASVSVSQLFSYPFRIFFLSMTVLALAVIPLWVMQVNGVISLPLAMPGLFW
HQHEMLFGFLSAAIAGFLLTAVCVWTQTERTHGFRLVLLWGVWLAGRVLLATGADLPFWL
VQGVNLAFLPLVVVDAGWRIWHARQKRQLMIMVILGLLWLMQIGFVTRLDMAFSYGALVM
AMALISIVGGRITPAFSTGWLRQRGLDSNAVKTIPALDMATVFSLILLMVSLVTGWQTVT
GLLALLSGGLMLVRLAGWKGWLVRQEPLLWILHLSILWVPVALFLLAGTLFAGWPSNAWS
HAAGTGAVACLILGVIARVALGHSGRPLVLPKGMVFAFVAIHLAALVRVLTAFEIIPWHP
GIGGSALLWLVAFGIFLYRYTAILASPRPDGREG