Protein Info for PGA1_c30820 in Phaeobacter inhibens DSM 17395

Annotation: putative ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 114 to 139 (26 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 134 to 310 (177 residues), 80.7 bits, see alignment E=5.8e-27

Best Hits

Predicted SEED Role

"sugar ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQX8 at UniProt or InterPro

Protein Sequence (320 amino acids)

>PGA1_c30820 putative ABC transporter permease protein (Phaeobacter inhibens DSM 17395)
MTRDWWKHLILILGVIVVIAPFYMMVSYSFKSPGEIDRGEGGFFGRQEMMVDERCVKLRD
PNRKDVAAAAHRFPGASDGEIRDALVAEAKADCAMRPVVFNYSKAFTEAPLLRYLLNGII
VTGSIFLIQVVVALPAAYALAKLKFWGREAVFGLVLFCLLIPVHAIALPLYIMLAKLGLT
NTYAALVVPWTISVFGIFLMRQFFMTVPDDLIDAARMDGMGEFSIVWRVMLPTAIPALLA
FAIFSIVAHWNDYFWPRIVVTGNRDLFTPPLGLREFKGDGDGSYFGPMMATATVIVTPLI
VAFLLAQKRFIEGITLSGMK