Protein Info for PGA1_c30810 in Phaeobacter inhibens DSM 17395

Annotation: putative ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 84 to 109 (26 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 321 (223 residues), 48.3 bits, see alignment E=5e-17

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 82% identity to sil:SPO1822)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0I7 at UniProt or InterPro

Protein Sequence (326 amino acids)

>PGA1_c30810 putative ABC transporter permease protein (Phaeobacter inhibens DSM 17395)
MTVTDTPLAPASKPATSGATQERRAAWSLTAPALILMFAILLVPVLIAGFLSFTNYSLGN
SGFDWVGTRNYEKLFTRSTYEKMFVATFTYVVTVVPISVGLGLGAALLINSLGRFREVYK
TIYFLPVMATLLAMAIAWEFMLHPSIGMINRTLEMGCGTPLEWLWPFMAQGCADGFPVWL
GDKRYAIWVVCFIGIWQGFGFNMVLYLAGLTGVHRELYHAAEMDGAKSGWERFRLVTWPA
LGPTTVFVVTISCIRAFQVFDTIEAFWPQGGGPNKSTYVMMFAIFEKGVQQNLIGIGSAI
TVLFLIFVMFLTLIQRWLVERKVHYG