Protein Info for HP15_2976 in Marinobacter adhaerens HP15

Annotation: conserved hypothetical protein, membrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 410 to 437 (28 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNA7 at UniProt or InterPro

Protein Sequence (450 amino acids)

>HP15_2976 conserved hypothetical protein, membrane (Marinobacter adhaerens HP15)
MEDRPELPGWRWGPFTFRVPFYHTRLCWSEFLQGLFVSAATGLALIPVMTAFFGLSFEEA
VALSMIHASLIASAVIVFGEPYAGGWITPALPLILAFVIGGYEDPVSRFQAMTALSLVFA
SLVLFLGITGLGRRFVIWLPDTLKAGIILGASIAALKRVFVDDAERFLLEQPIATGLACA
ICLIFTFSIPMQKLKERSRFFFMLGALGLLPGFLAAAIVGPLVGEVDFDIQWGILVPPLG
EALAKVSPLAIGWPSQEMILQSIPLALIAYIILFGDLVTGNEVLRDGLKVRKDEHVDINL
NRTHFSLSIRNAIMGIVAPFFPTQGAVWTGVHVIVVQRWKQGPKAMNSLHSGLASYYLMG
LPFIFFLLPLLTGLKPLLGVALSLTLVLTGFACAYIAMSIPRDNASRGTVVLIGAALAFF
EPWMGLLIGVVATLALVGWDRSPDPIPHDE