Protein Info for PGA1_c03150 in Phaeobacter inhibens DSM 17395

Annotation: putative acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 PF02771: Acyl-CoA_dh_N" amino acids 42 to 156 (115 residues), 48.5 bits, see alignment E=3.1e-16 PF02770: Acyl-CoA_dh_M" amino acids 161 to 269 (109 residues), 49 bits, see alignment E=1.7e-16 PF00441: Acyl-CoA_dh_1" amino acids 280 to 436 (157 residues), 93.4 bits, see alignment E=4.7e-30 PF22924: ACOX_C_alpha1" amino acids 290 to 431 (142 residues), 32.3 bits, see alignment E=2.5e-11 PF08028: Acyl-CoA_dh_2" amino acids 296 to 429 (134 residues), 36.2 bits, see alignment E=2.1e-12 PF12806: Acyl-CoA_dh_C" amino acids 451 to 557 (107 residues), 50.6 bits, see alignment E=6.5e-17

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 81% identity to sit:TM1040_3059)

Predicted SEED Role

"3-methylmercaptopropionyl-CoA dehydrogenase (DmdC)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIT0 at UniProt or InterPro

Protein Sequence (568 amino acids)

>PGA1_c03150 putative acyl-CoA dehydrogenase (Phaeobacter inhibens DSM 17395)
MTFRAPVPEYQFLLNHIVGYSDISATDRFSEASDDVVTAILTEAGKFCDEVMAPLNRGGD
LQPAHLENGVLRTSPGYAEGWQAISEGGWIGMSASEAFGGMGLPMTLTTAVNEMMSGACL
SLQLAPLMSQGQIEALEHHASDEIKSLYLPKLISGEWSGTMNLTEPQAGSDVGALSSKAD
PLDDGTYAISGQKIYISWGDNDFAGNICHLVLARLPDAAPGTKGISLFLVPKYLPDADGN
PGKANDLKVVSLEHKMGLHGSPTCVMQYDGAIGWMIGQPGGGLAAMFTMMNNARLGVGGQ
GVGIAGAAYQKALAYALERKQGKSASGTIVDHADVRRMLMEMKADLFAARAILLACSQAI
DMQTATATQEWAARAAFLTPIAKAFGTETGMRVSETGVQVHGGMGFIEETGAAQFYRDVR
VTAIYEGTNGIQAMDLVGRKMMDGGDMAHRLIDEIEEQAERARTTHPNMAEAVWQACESL
REATEWLTAQDDMDERFAGAVPFLHAFARVLGGHYHLAAAMADIGGPREELARFYINRML
PEHAALLAHAQAGSAGARALTLDELVDG