Protein Info for HP15_2967 in Marinobacter adhaerens HP15

Annotation: cation efflux family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 20 to 23 (4 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 2 to 266 (265 residues), 264.7 bits, see alignment E=4.9e-83 PF01545: Cation_efflux" amino acids 2 to 184 (183 residues), 141.5 bits, see alignment E=1.5e-45

Best Hits

Swiss-Prot: 38% identical to CZCD_CUPMC: Metal cation efflux system protein CzcD (czcD) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 58% identity to mxa:MXAN_5264)

MetaCyc: 36% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PN98 at UniProt or InterPro

Protein Sequence (276 amino acids)

>HP15_2967 cation efflux family protein (Marinobacter adhaerens HP15)
MLNVVFVAIEAVYGVLSGSLALLADAGHNLSDVLGLVMAWVASWLATQKATDRNTYGLKK
STILAALFNALFLIAAVGGIAWEAIGRFSEPAEVTGLTVIVVAGIGVIINGLTMLLFMKG
QEGDLNIRGAFLHMAADTAVSVGVVVAGLVILFTGLDWIDPLVSLVIAAVIFMGTWQLLK
DSLSLAVDAVPRDINPQEVLDSLKGLPGVESVHHLHIWGLSTTENALTVHLVKPDPSSDD
QIIEQATRMLASDFNIQHVTIQWEREASNCPTLAYC