Protein Info for Psest_0303 in Pseudomonas stutzeri RCH2

Annotation: Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF01339: CheB_methylest" amino acids 155 to 330 (176 residues), 131.1 bits, see alignment E=1.9e-42

Best Hits

KEGG orthology group: K06597, chemosensory pili system protein ChpB (putative protein-glutamate methylesterase) (inferred from 94% identity to psa:PST_3947)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHX3 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Psest_0303 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain (Pseudomonas stutzeri RCH2)
MSEVLCARIAVLADTSLQRHVLQQALTGSGYQVVLNNDPARLEPADLDSTEADLWLVDLA
QTEDSPLVDALLERDTTRVLFGEGHAPERHSEFYPRWERSLFSKLKRLVGDPSRAVGPRL
DVLQGEGQRPERLTLPPLLADTALLAGEPASQVWLLAASLGGPEAVKAFLDALPGGLPVG
FIYAQHIEASFESALSQAVGRHSQWQVRQVRAGEPVRCGEVVIAPIAEELGFDSDGNARL
NGRCWPEPYSPSIDQMMLNLAQQFGERCGVIAFSGMGSDGSAAAAYVLRQGGKVWTQRAD
SCACSSMPDNLREGGYSSYSGDSRELAQALVNHLVNQVGTPTTSFKRDNS