Protein Info for Psest_3075 in Pseudomonas stutzeri RCH2

Annotation: sodium/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 66 to 93 (28 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details amino acids 429 to 447 (19 residues), see Phobius details amino acids 454 to 474 (21 residues), see Phobius details TIGR02121: sodium/proline symporter" amino acids 6 to 489 (484 residues), 741.3 bits, see alignment E=4.9e-227 PF00474: SSF" amino acids 35 to 437 (403 residues), 439.6 bits, see alignment E=5.6e-136 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 35 to 437 (403 residues), 397.7 bits, see alignment E=6.5e-123

Best Hits

Swiss-Prot: 74% identical to PUTP_ECOLI: Sodium/proline symporter (putP) from Escherichia coli (strain K12)

KEGG orthology group: K11928, sodium/proline symporter (inferred from 98% identity to psa:PST_1246)

MetaCyc: 74% identical to proline:Na+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-118; TRANS-RXN0-505

Predicted SEED Role

"Proline/sodium symporter PutP (TC 2.A.21.2.1) @ Propionate/sodium symporter" (TC 2.A.21.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNK7 at UniProt or InterPro

Protein Sequence (494 amino acids)

>Psest_3075 sodium/proline symporter (Pseudomonas stutzeri RCH2)
MNVSTPTLITFVIYIAAMILIGFIAYRATKNFSDYILGGRSLGSFVTALSAGASDMSGWL
LMGLPGAIFVAGLSESWIAIGLIVGAWLNWLFVAGRLRVHTEHNHNALTLPDYFSHRFED
ESRMLRIFSALVILVFFTIYCASGVVAGARLFESTFGMPYEYALWVGAAATILYVFIGGF
LAVSWTDTVQATLMIFALLVTPVFVILALGDMGTAMATIEAQNPANFDMFRGLSFVAIVS
LLAWGLGYFGQPHILVRFMAADSIKTIPNARRIGMTWMILTLAGAVAVGFLGIAYFADHP
EQAGAVSQNGERVFMELVKILFNPWVAGIILSGVLAAVMSTLSAQLLVSSSALTQDFYKA
MLRKNASQTELVWVGRGMVLLIALIAIGIASNPDSKVLGLVSYAWAGFGAAFGPVVLISL
LWKRMTRNGALVGMLVGAVTVVVWKEFIGLGLYEIIPGFILASIAIFVVSKLGAEPAPSI
VKRFEEADADYHAG