Protein Info for PGA1_c30530 in Phaeobacter inhibens DSM 17395

Annotation: HTH-type transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF12833: HTH_18" amino acids 29 to 107 (79 residues), 66.9 bits, see alignment E=3.3e-22 PF06445: GyrI-like" amino acids 129 to 278 (150 residues), 136.5 bits, see alignment E=1.9e-43 PF14526: Cass2" amino acids 134 to 263 (130 residues), 52.3 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: K13652, AraC family transcriptional regulator (inferred from 70% identity to sil:SPO3615)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2S7 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PGA1_c30530 HTH-type transcriptional regulator, AraC family (Phaeobacter inhibens DSM 17395)
MSSSYENRILRVLGYIYDNPEGDLSLDALADVAAMSRFHWHRVFRALTGETCAQAVRRIR
LHLAATALVQGAAPIESIGRAAGYPNTRSFARVFAEAYGASPAAFRRKGRLLPPNPTLMS
QGDPMYPTIIRTEPARTLAALAHKGAYSEIGRSFEAFSALCTARNLWPQMRQMIGVYLDS
PDTVPDAELRSYAGASMAEGVALPEGMEVVTLPGGKTAVMTYKGPYSGIHAAYGDLFGAW
LPQSGEEPADAPCYEIYLNDPHQVAPEELLTEICLPLK