Protein Info for Psest_0030 in Pseudomonas stutzeri RCH2

Annotation: Putative NADH-flavin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF13460: NAD_binding_10" amino acids 15 to 142 (128 residues), 38.1 bits, see alignment E=7.6e-14

Best Hits

KEGG orthology group: None (inferred from 84% identity to psa:PST_0028)

Predicted SEED Role

"putative NADH-flavin reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GD47 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Psest_0030 Putative NADH-flavin reductase (Pseudomonas stutzeri RCH2)
MLNAETPRLKFALYGAHDDLGSALLVELLSRQHEAVALLDDLNSISARPGLRTKPGDPFD
AMSVSESVAGMDAVICLFQTPRLPGPGRITGESPQRDFYQAVEALLLGLERARVERLLLV
ADYPAIELQPEVEAALQRLAKHPLRWTLVDAPSAGNQLTIETLAEAAGKGDANPYRELQR
IAAGIVDELENPQHIHQRIHFSG