Protein Info for PGA1_c30420 in Phaeobacter inhibens DSM 17395

Annotation: alanine dehydrogenase Ald

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 TIGR00518: alanine dehydrogenase" amino acids 1 to 367 (367 residues), 521.4 bits, see alignment E=5.9e-161 PF05222: AlaDh_PNT_N" amino acids 4 to 137 (134 residues), 167.4 bits, see alignment E=8e-53 PF01262: AlaDh_PNT_C" amino acids 141 to 352 (212 residues), 297.4 bits, see alignment E=2.2e-92 PF07992: Pyr_redox_2" amino acids 164 to 212 (49 residues), 27.2 bits, see alignment 1e-09 PF02826: 2-Hacid_dh_C" amino acids 167 to 268 (102 residues), 36.5 bits, see alignment E=1.3e-12 PF01488: Shikimate_DH" amino acids 167 to 268 (102 residues), 25.1 bits, see alignment E=6.5e-09 PF00070: Pyr_redox" amino acids 170 to 220 (51 residues), 28.1 bits, see alignment 9.8e-10 PF03807: F420_oxidored" amino acids 170 to 268 (99 residues), 22.4 bits, see alignment E=6.1e-08

Best Hits

Swiss-Prot: 62% identical to DHA_HALED: Alanine dehydrogenase (ald) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 91% identity to sit:TM1040_3628)

MetaCyc: 56% identical to L-alanine/glycine dehydrogenase monomer (Mycobacterium tuberculosis H37Rv)
Glycine dehydrogenase. [EC: 1.4.1.10]; Alanine dehydrogenase. [EC: 1.4.1.10, 1.4.1.1]

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1 or 1.4.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4I1 at UniProt or InterPro

Protein Sequence (371 amino acids)

>PGA1_c30420 alanine dehydrogenase Ald (Phaeobacter inhibens DSM 17395)
MKIGCPTEIKPQEFRVGMTPDAAREAVNHGHTVLIQAGAGMGAGFTDEDYTTAGAAIIDT
AEEIFATADMIVKVKEPQAVERKMLREGQLLFTYLHLAPDPDQTRDLLDSGCTAIAYETV
TDDRGGLPLLAPMSEVAGRLAPQVGAYTLQKANGGRGVLMGGVPGVAPAKVVVIGGGVVG
THAAKIAAGMGADVTILDRSLARLKYLDDVFGRDFKNQYSTAGATAELVRDADMVIGAVL
IPGAAAPKLVSRAQLSEMKPGAVLVDVAIDQGGCFETSKATTHADPIYEVDGIMHYCVAN
MPGAVARTSTQALGNATLPFLLNLANKGWKQACADDPHLLNGLNVHAGKLTYFAVGKALG
IDVVSPQLMIK