Protein Info for PGA1_c30390 in Phaeobacter inhibens DSM 17395

Annotation: putative polyphosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF03976: PPK2" amino acids 50 to 273 (224 residues), 346.9 bits, see alignment E=2.7e-108 TIGR03707: polyphosphate kinase 2" amino acids 51 to 275 (225 residues), 363 bits, see alignment E=3.5e-113

Best Hits

Swiss-Prot: 85% identical to PK21A_RUEPO: Polyphosphate:NDP phosphotransferase 1 (SPO0224) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: None (inferred from 94% identity to sit:TM1040_3630)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUD3 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PGA1_c30390 putative polyphosphate kinase (Phaeobacter inhibens DSM 17395)
MTSDHDPDSFDWLDAELQDTLDEDFEIEFAEPMLSMELRKIYRSQHPEMLDRKVYFRNLL
RLQAELIKVQDWVQHTGAKVCILFEGRDSAGKGGVIKRITQRLNPRVARVVALPAPSRRE
QSQWYFQRYVPYLPAAGEIVLFDRSWYNRAGVERVMGFASDDQVEQFFQDVPEFERMLVR
SGIILLKYWFSITDEEQQLRFLMRIHDPMKQWKLSPMDLESRIRWEQYTKAKEDMFERTN
IPEAPWYIVEGNDKKRERLNCIEHLLTKIPYCDVPSERVSLPDREYKPDYERRVLPDDLY
VPKIY