Protein Info for Psest_3044 in Pseudomonas stutzeri RCH2

Annotation: deoxycytidine triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 4 to 187 (184 residues), 168.9 bits, E=4.5e-54
• PF00692: dUTPase
  • amino acids 71 to 184 (114 residues), 32.1 bits, E=4.1e-12

Best Hits

Swiss-Prot: 97% identical to DCD_PSEU2: dCTP deaminase (dcd) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 96% identity to pst:PSPTO_4144)

MetaCyc: 69% identical to dCTP deaminase (Rickettsia prowazekii Madrid E)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See L0GP34 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Psest_3044 deoxycytidine triphosphate deaminase (Pseudomonas stutzeri RCH2)
MSIKSDKWIRRMAQEHGMIEPFVERQVRTEGNDRLISYGVSSYGYDVRCADEFKVFTNIN
SATVDPKNFDEKSFVDIKSDVCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGII
VNVTPLEPEWEGHVTLEFSNTTTLPAKIYANEGVAQMLFLESDEECEVSYRDRGGKYQGQ
RGVTLPKA