Protein Info for PGA1_c30350 in Phaeobacter inhibens DSM 17395

Annotation: putative quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 5 to 326 (322 residues), 472.4 bits, see alignment E=3.2e-146 PF08240: ADH_N" amino acids 31 to 113 (83 residues), 60.8 bits, see alignment E=2e-20 PF00107: ADH_zinc_N" amino acids 155 to 273 (119 residues), 91.2 bits, see alignment E=8.2e-30 PF13602: ADH_zinc_N_2" amino acids 187 to 324 (138 residues), 89.3 bits, see alignment E=6.3e-29

Best Hits

KEGG orthology group: None (inferred from 80% identity to sit:TM1040_2517)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQT3 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PGA1_c30350 putative quinone oxidoreductase (Phaeobacter inhibens DSM 17395)
MTEMMRAIEIQEPGGPSVLQACQRPVPSPGHGQVVLKVAYAGVNRPDALQRAGKYAPPPT
ASDLPGLEASGEVVAIGAGVSELTVGDRVCALLPGGGYAEYVATPAAHCLPVPAGLSMKQ
AACLPETCFTVWSNVFTRGGLQAGERFLVHGGSSGIGTTAIQLASQLGARVFTTAGSDEK
CAVCLKLGAERAINYRDEDFVEVLKTEGGANLILDMVGGDYIPRNVRALADDGRMVHIAF
LSGPKVELNFAQIMARRLTLTGSTLRPQSDLAKAQIAQDLREVVWPLIEAGKFAPVMDQT
FALEEAAAAHARMESSAHIGKIVLEVGGEG