Protein Info for PGA1_c30290 in Phaeobacter inhibens DSM 17395

Annotation: recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 TIGR00615: recombination protein RecR" amino acids 5 to 197 (193 residues), 197.3 bits, see alignment E=9.2e-63 PF21176: RecR_HhH" amino acids 9 to 51 (43 residues), 31.8 bits, see alignment 2.5e-11 PF02132: RecR_ZnF" amino acids 57 to 76 (20 residues), 23.1 bits, see alignment (E = 1.3e-08) PF13662: Toprim_4" amino acids 82 to 171 (90 residues), 86.1 bits, see alignment E=3.9e-28 PF01751: Toprim" amino acids 83 to 163 (81 residues), 30.6 bits, see alignment E=7.9e-11 PF21175: RecR_C" amino acids 174 to 197 (24 residues), 37.9 bits, see alignment (E = 2.4e-13)

Best Hits

Swiss-Prot: 86% identical to RECR_RUEST: Recombination protein RecR (recR) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K06187, recombination protein RecR (inferred from 86% identity to sit:TM1040_0164)

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4H0 at UniProt or InterPro

Protein Sequence (199 amino acids)

>PGA1_c30290 recombination protein RecR (Phaeobacter inhibens DSM 17395)
MIKNSTTDIEDLIALMAKLPGLGPRSARRAVLHLIRKRALLLTPLAETMSEVAATARECL
NCGNVGTGDLCTICEDMTRANGELCVVEDVSDLWAMERAAVFKGRYHVLGGTLSALDAVG
PEDLRIPRLVDRVQAEQVSEVILALNATIDGQTTAHYIADQLSGQVRLTSLAQGVPIGGE
LDYLDEGTITAALRARKDI