Protein Info for Psest_3038 in Pseudomonas stutzeri RCH2

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 242 (221 residues), 112.5 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 47% identical to YNFM_ECOLI: Inner membrane transport protein YnfM (ynfM) from Escherichia coli (strain K12)

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 91% identity to psa:PST_1271)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNI1 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Psest_3038 Arabinose efflux permease (Pseudomonas stutzeri RCH2)
MIDDSAHLRRGTPAYRRATLALFCAGFATFALLYCIQPLLPMLAAHFSVSAASSSLALSL
TTLSLALCLLISGALAESWGRKPVMAAALGLASLLGLASVLVDSWQLLLALRALLGLALS
GLPALAMAYVGEEFEPQSLPAAMGLYIGGTALGGMLGRLLSGLLSDLGGWQLALGGIASL
GLLALALFVWLLPASRHFKAQPLSLRNLLANFRLHLRNPTLRSLFLQGFLLMGGFVALFN
YIGFRLAGEPFGLSSTLIGLLFVVYLGGIFSAGWAGRLVPRFGARQVLRGGVVLMLLGVG
LCATPWLAAIVLGLGLFTLGFFAAHAVASGQVGSHAKQARAQASALYLCAYYLGSSVVGY
GAGYVWDHAGWLPLMALLAALFVIAGWRARAL