Protein Info for PGA1_c30260 in Phaeobacter inhibens DSM 17395

Annotation: DNA polymerase III subunit tau

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 14 to 374 (361 residues), 425.2 bits, see alignment E=1.1e-131 PF13177: DNA_pol3_delta2" amino acids 32 to 194 (163 residues), 126.3 bits, see alignment E=3.7e-40 PF07728: AAA_5" amino acids 52 to 164 (113 residues), 23.2 bits, see alignment E=1.8e-08 PF00004: AAA" amino acids 53 to 188 (136 residues), 41.3 bits, see alignment E=6.2e-14 PF22608: DNAX_ATPase_lid" amino acids 203 to 246 (44 residues), 49.1 bits, see alignment 1.1e-16 PF12169: DNA_pol3_gamma3" amino acids 249 to 390 (142 residues), 186.2 bits, see alignment E=8.5e-59 PF12362: DUF3646" amino acids 466 to 578 (113 residues), 122.8 bits, see alignment E=2.6e-39

Best Hits

KEGG orthology group: K02343, DNA polymerase III subunit gamma/tau [EC: 2.7.7.7] (inferred from 82% identity to sit:TM1040_0166)

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUC5 at UniProt or InterPro

Protein Sequence (606 amino acids)

>PGA1_c30260 DNA polymerase III subunit tau (Phaeobacter inhibens DSM 17395)
MSDTAGDTAGQSQYQVLARKYRPETFADLVGQDAMVRTLKNAFAADRIAQAFIMTGIRGT
GKTTTARIIAKGMNCIGEDGQGGPTTEPCGKCEHCTAIMEGRHVDVMEMDAASRTGVGDI
REIIDSVQYRAASARYKIYIIDEVHMLSTSAFNALLKTLEEPPAHVKFIFATTEIRKVPV
TVLSRCQRFDLRRIEPEVMIGLLQKIAGAENAQIAEDALALITRAAEGSARDATSLLDQA
ISHGAGETTADQVRAMLGLADRGRVLDLIDMILRGDAAAALTELSAQYAEGADPLAVLRD
LAEITHWVSVVKITPDAAEDPTVSPDERARGSQMAEALPMRVLTRMWQMLLKALEEVAAA
PNAMMAAEMAVIRLTHVADLPTPEQLMRTLQDTPPPPPPSGHMNAPMGSSGGPSGAPQGA
GGYVPQQPGPQGGMPSGPQGGPTMSTGNGQATALAPQVDSALARYPSFEHVIELIRVKRD
GLLLEYVKTYLRLVSYQPGRITIQPTDDAPKDLAARLGQQLQTWTHARWVISLANEGGGE
TITERDNAAENALRAEASTHPMVQAVLESFPKAKIRHIRTAEDLAAEVEAEALPEVEDEW
DPFEEE