Protein Info for HP15_2920 in Marinobacter adhaerens HP15

Annotation: amino acid ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00005: ABC_tran" amino acids 20 to 171 (152 residues), 140.5 bits, see alignment E=8.1e-45

Best Hits

Swiss-Prot: 63% identical to GLUA_CORGL: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: None (inferred from 93% identity to maq:Maqu_3047)

MetaCyc: 36% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Glutamate transport ATP-binding protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PN51 at UniProt or InterPro

Protein Sequence (248 amino acids)

>HP15_2920 amino acid ABC transporter, ATP-binding protein (Marinobacter adhaerens HP15)
MTQIVKMKGMNKYFGKLHVLKDIDLTVEQGEVVVIIGASGSGKSTLIRCVNGLEEYESGT
LEVDGQQLAPKSGNPKALAEIRKEVGMVFQQFNLFPHLTVKRNIMLAPKKVKETPETVAN
ATAERLLNRVGIGNQADKYPSQLSGGQQQRVAIARALAMEPRLMLFDEPTSALDPEMIGE
VLDVMRELAKEGMTMMVVTHEMGFAREVADRVIYIHEGAIVEQGKPDDVFDNPQNERTQA
FLSRVLAH