Protein Info for PGA1_c30220 in Phaeobacter inhibens DSM 17395

Annotation: putative NADH pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF09296: NUDIX-like" amino acids 37 to 161 (125 residues), 45.2 bits, see alignment E=2.1e-15 PF09297: zf-NADH-PPase" amino acids 163 to 194 (32 residues), 33.7 bits, see alignment 3.5e-12 PF00293: NUDIX" amino acids 200 to 303 (104 residues), 61.9 bits, see alignment E=1e-20

Best Hits

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 68% identity to sil:SPO3541)

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0E1 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PGA1_c30220 putative NADH pyrophosphatase (Phaeobacter inhibens DSM 17395)
MRQAEHVTFGGSGLDRAAHLRDDPAALAALWSGGDCRILLIWRGKPLCSLPSEVAVASDK
GILPVALAWVRSDHPVAKGAAVAAVFLGICTAGRARFSVDISDWQPDNLDDMALRAFVDN
SEQRHPDLPQETGFVELRRIMAQLRREEAELAATARAVFGWHHSHGYCACCGAKSDMVQG
GWQRVCLSCGAAHFPRTDPVVIMLITHGDAVLVGRSPGWPDGMYSLLAGFVEPGETLEAA
VRRETAEETGVKVGAVSYLSSQPWPFPMSLMFGCAGEALGREITIDPKEIEDAIWVSRQD
MMAIFEGTHPDIRQPRKGAIAHFLLQNWLADTLD