Protein Info for PGA1_c30190 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome c-552

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00034: Cytochrom_C" amino acids 71 to 165 (95 residues), 32.2 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 47% identical to CY552_PARDE: Cytochrome c-552 (cycM) from Paracoccus denitrificans

KEGG orthology group: K08738, cytochrome c (inferred from 68% identity to rde:RD1_1262)

Predicted SEED Role

"membrane c-type cytochrome cy" in subsystem Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4G0 at UniProt or InterPro

Protein Sequence (167 amino acids)

>PGA1_c30190 cytochrome c-552 (Phaeobacter inhibens DSM 17395)
MFDTMTLTKATAGVCGAFLVFLLGKWAAEELYHTESHGEASYVIEVEEAGAEEVAEVVDF
GELMAAADVGKGAKVFKKCSACHKLEAGENATGPYLYGVVDRPIAAADGFGYSATLAGLG
GEWTAEELDAFLTKPSQYAPGTTMSFSGLKKQKDRVNLIAYLDSLDD