Protein Info for PGA1_c30160 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 168 to 194 (27 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 284 to 310 (27 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details PF12911: OppC_N" amino acids 8 to 44 (37 residues), 26.9 bits, see alignment 3.6e-10 PF00528: BPD_transp_1" amino acids 184 to 365 (182 residues), 103.7 bits, see alignment E=1e-33

Best Hits

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 86% identity to sit:TM1040_2550)

Predicted SEED Role

"Oligopeptide/dipeptide uptake family ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUB7 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PGA1_c30160 ABC transporter permease protein (Phaeobacter inhibens DSM 17395)
MALSPLNQRRWSNFCRNRRAFWSLWIFSVLFGISLFAEFVANDKPMLVSYRGEYFTPVFN
FYPETAFGGDFQTEAAYRDPEVQCLIASGGVEDCFDDPEGILEEIETGTFAAEGFVEGWA
IWPPIPYSFNTTVDRPGAAPLPPNGQNLLGTDDTKRDVLARVIHGFRLSILFTLMVTGAA
TLVGIAAGAVQGFFGGWLDLIFQRVIEIWGSIPQLYVIIIMFAILGRSFWLLVVLMILFS
WTALVSVVRAEFLRARNLEYVRAAKALGVGNMTIMFRHMLPNAMVATLTFLPFIVTGTIG
TLAGLDFLGFGLPSSAPSLGELTLQAKQNLEAPWLAFTAFFTFAIMLSLLVFIFEGVRDA
FDPRKTFS