Protein Info for PGA1_c30150 in Phaeobacter inhibens DSM 17395

Annotation: oligopeptide/dipeptide ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 PF00005: ABC_tran" amino acids 35 to 192 (158 residues), 104.1 bits, see alignment E=3.8e-33 amino acids 310 to 460 (151 residues), 109.5 bits, see alignment E=8.3e-35 PF08352: oligo_HPY" amino acids 243 to 270 (28 residues), 28.9 bits, see alignment (E = 5.1e-10) amino acids 511 to 534 (24 residues), 17 bits, see alignment (E = 2.6e-06)

Best Hits

KEGG orthology group: K13896, microcin C transport system ATP-binding protein (inferred from 84% identity to sit:TM1040_2549)

Predicted SEED Role

"Oligopeptide/dipeptide uptake family ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2P6 at UniProt or InterPro

Protein Sequence (536 amino acids)

>PGA1_c30150 oligopeptide/dipeptide ABC transporter, ATP-binding protein (Phaeobacter inhibens DSM 17395)
MGNSMTVTQKPTPLLSVRDLRVSFRQDGKVTEAVRGVSFSVGRGETVALVGESGSGKSVS
ALSTVSLLGDSATVSGSVTYDGTEMVGASERHLRQVRGNDISFIFQEPMTSLNPLHTIEK
QLAESLALHQGLGGAAARERIVDLLNRVGIRDAETRLDAYPHQLSGGQRQRVMIAMALAN
KPDILIADEPTTALDVTIQVQILDLLADLKASEGMGLLFITHDLSIVRRIADRVCVMQAG
EIVESGPTAEIFANPQHPYTRKLLDAEPTGQPQPVSKDAKELIRTEDLKVWFPIQKGFLK
RTVGHVKAVNPTSLSVRAGETLGIVGESGSGKTTLALAIMRLIASEGRVEFQGQDLRQWS
TRDLRRLRADMQIVFQDPFGALSPRMTCAQIIAEGLAIHNVDQDRDPRDLVAEVMSEVGL
DPAFMDRYPHEFSGGQRQRIAIARAMVLRPKLVVLDEPTSALDMTVQVQIVNLLRDLQER
YGLAYLFISHDLNVVRAMSHKMIVMKQGDVVEAGSAAELFNNPSDPYTQQLLAAAG