Protein Info for PGA1_c30110 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome c oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 87% identity to sil:SPO3525)

MetaCyc: 74% identical to cytochrome cbb3 oxidase subunit II (Rhodobacter capsulatus)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

aerobic respiration I (cytochrome c) (3/4 steps found)
arsenite to oxygen electron transfer (1/2 steps found)
aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
NADPH to cytochrome c oxidase via plastocyanin (thylakoid membrane) (1/4 steps found)
Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUB1 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PGA1_c30110 cytochrome c oxidase subunit 2 (Phaeobacter inhibens DSM 17395)
MGILDKHKILETNATLLLVCSFLVVTIGGLVQIAPLFWLENTIEEVEGMRPYTPLELAGR
DIYIREGCYVCHSQMIRPMRDEVERYGPYSLAAESMYDHPFQWGSKRTGPDLARVGGRYS
DEWHVDHLRDPQSVVPESVMPKYGFLENNRIDGEYIGDVMAANAFVGVPYSDTMLENARA
DFRAQSNPDADYDGLLERYGEKVSVRNFDGQPGISEADALIAYLQMLGTLVDFSTFTPVA
NR