Protein Info for HP15_2899 in Marinobacter adhaerens HP15

Annotation: rhodanese sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF17773: UPF0176_N" amino acids 7 to 97 (91 residues), 95.7 bits, see alignment E=1.8e-31 PF00581: Rhodanese" amino acids 117 to 212 (96 residues), 48.4 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 66% identical to Y1846_FRAP2: UPF0176 protein Fphi_1841 (Fphi_1841) from Francisella philomiragia subsp. philomiragia (strain ATCC 25017)

KEGG orthology group: K07146, UPF0176 protein (inferred from 91% identity to maq:Maqu_3012)

Predicted SEED Role

"Rhodanese domain protein UPF0176"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMF1 at UniProt or InterPro

Protein Sequence (340 amino acids)

>HP15_2899 rhodanese sulfurtransferase (Marinobacter adhaerens HP15)
MMSNNVVVCALYKFAVLNDYKSLRQPLLDLMLDKDVHGTLLLAREGINGTIAGSREGIDA
VKAWIASDERFDGIDYKESFVDIQPFKRTKVKLKKEIVTMGVDGIDPKRIVGTYVDPKEW
NNLISDPDVVLVDTRNQYEVEIGTFRNAVNPATDTFREFPEYVKQNLDPSKHKKVAMFCT
GGIRCEKSTAYLKEQGFEEVYHLKGGILKYLEEVPEEQSLWHGECFVFDDRVTVNHRLER
GDYDQCHACRRPITEEDKQRPEYEQGVSCHQCIDSLTEEQKARFAERERQMRLAEERGEA
HVGGEAARIIAERKARKKAERERQARKSLDGERARSTDGA