Protein Info for PGA1_c29990 in Phaeobacter inhibens DSM 17395

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 271 to 291 (21 residues), see Phobius details PF05175: MTS" amino acids 158 to 321 (164 residues), 160 bits, see alignment E=4.4e-51 PF13649: Methyltransf_25" amino acids 189 to 264 (76 residues), 32.1 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 59% identity to sit:TM1040_2533)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4E0 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PGA1_c29990 methyltransferase (Phaeobacter inhibens DSM 17395)
MSVRLSLAVETGGFPVPETGRVGVFHPASDVDLSALPKERVLIVQPFAPDHAALAARGYE
CVPELPADVRFAASVVFLSRAKALTRGLLAQAAELSDGPVLVDGGKTDGVDSVLKALRAR
CDVSAPISKAHGKAFWFDATGTDLSDWQVATTQIDGGFQTAPGVFSADGVDPASALLVAA
LPAKLGRNVVDLGAGWGYLSSAVLQRETVQALHLVEADHSALSCARQNINDPRAQFHWAD
ARSWQTTERVDCVISNPPFHTSRAAEPSLGQAFITAASGMLAPAGAFWLVANRHLPYEAT
LAEQFATVSEVAGDNRFKVLQASRPRRHRR