Protein Info for Psest_3005 in Pseudomonas stutzeri RCH2

Annotation: Fructose-2,6-bisphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 78% identity to psa:PST_1300)

Predicted SEED Role

"Alpha-ribazole-5'-phosphate phosphatase (EC 3.1.3.73)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 3.1.3.73)

MetaCyc Pathways

superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
2-methyladeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-hydroxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-methoxy-6-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-methoxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
adeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
adenosylcobalamin biosynthesis from adenosylcobinamide-GDP I (3/3 steps found)
benzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
4-methylphenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
phenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
adenosylcobalamin biosynthesis from adenosylcobinamide-GDP II (2/4 steps found)
adenosylcobalamin biosynthesis II (aerobic) (21/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (20/36 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQC9 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Psest_3005 Fructose-2,6-bisphosphatase (Pseudomonas stutzeri RCH2)
MTTRIDLLRHGETEQGGGFRGSLDDALTERGWQQMHDAVGHAGPWDVLVSSPLQRCAAFA
HELAAQHDVPLRLEPDLRELHFGDWEGRSAAELMQDSAEALGLFWADPYGFTPPGGEPLV
QFEARVLSAMTRLQQRFAGQRVLIVGHAGVMRLLLARARGLPREQLLEVVVAHGELLPLS
PFPAGELTAVGE