Protein Info for Psest_3002 in Pseudomonas stutzeri RCH2

Annotation: Putative translation initiation inhibitor, yjgF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF01042: Ribonuc_L-PSP" amino acids 13 to 127 (115 residues), 94 bits, see alignment E=3.5e-31

Best Hits

Swiss-Prot: 62% identical to YJGH_ECOLI: RutC family protein YjgH (yjgH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 86% identity to pba:PSEBR_a3515)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNF3 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Psest_3002 Putative translation initiation inhibitor, yjgF family (Pseudomonas stutzeri RCH2)
MTPRDVVFPPGRQALYERNRYSPAIRANGLLFVSGQVGSREDGSPEPELEAQVRRAFNSL
NAILQAAGCTFDDVIDVTVFMVDPQSIFERVWSVVPEYWGAAPHPTLTAVGVTWLYGFQF
EIKVIAKLPEPAEA