Protein Info for HP15_2889 in Marinobacter adhaerens HP15

Annotation: membrane protein containing DUF6, transmembrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details PF00892: EamA" amino acids 4 to 153 (150 residues), 54.9 bits, see alignment E=5.8e-19 amino acids 166 to 302 (137 residues), 78.3 bits, see alignment E=3.6e-26

Best Hits

KEGG orthology group: None (inferred from 81% identity to maq:Maqu_3004)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PME1 at UniProt or InterPro

Protein Sequence (317 amino acids)

>HP15_2889 membrane protein containing DUF6, transmembrane (Marinobacter adhaerens HP15)
MIQGALLIALAALLWATTGIVAKFLFTGTELQAITLGFLRLAVALPFFWLLMRREQARLE
RANPGAKVPGSSLRSLTRQTLIPLAALGLFQAFYQGSYLLAVDLTGAGIATLIALCLPPV
LVAILAAPLLGEKPSLLTVLSLFAAIAGTGMLVLSDMDTTGTLRLAGILVALLAACVYTG
FTLTSRYSSTGTPVFTTAFICFFTAALILLPVVALSGGFEGLETLGIGHWLMVVYVGVVP
TCIGYVCFFSGMKTTPATLSSIIVTLEPLFVALLAWVFLEEILGPIGIAGALILTAAVVV
ASRYGRKPAAGQEAGAE