Protein Info for HP15_2887 in Marinobacter adhaerens HP15

Annotation: iron-sulfur cluster binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR00273: iron-sulfur cluster-binding protein" amino acids 25 to 449 (425 residues), 502.4 bits, see alignment E=5.6e-155 PF02589: LUD_dom" amino acids 76 to 300 (225 residues), 177.7 bits, see alignment E=9.2e-56 PF00037: Fer4" amino acids 315 to 331 (17 residues), 24 bits, see alignment (E = 1.1e-08) PF13183: Fer4_8" amino acids 317 to 383 (67 residues), 48.8 bits, see alignment E=3.4e-16 PF13534: Fer4_17" amino acids 318 to 383 (66 residues), 24.8 bits, see alignment E=9.9e-09 PF11870: LutB_C" amino acids 391 to 479 (89 residues), 96.4 bits, see alignment E=4.4e-31

Best Hits

Swiss-Prot: 50% identical to LUTB_BACAC: Lactate utilization protein B (lutB) from Bacillus anthracis (strain CDC 684 / NRRL 3495)

KEGG orthology group: None (inferred from 61% identity to tmz:Tmz1t_1716)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMD9 at UniProt or InterPro

Protein Sequence (479 amino acids)

>HP15_2887 iron-sulfur cluster binding protein (Marinobacter adhaerens HP15)
MSETAEHTGHHIDVKEFHPRAQAAIHDPKIRKNFRSAMDGLMSKRKTAFEGWDLETLRDL
GANVRLRALANLPDLLEQLEKKLIENGIKVHWAVDGDEACRIVRDICKARDAKTVIKGKS
MVSEEMELNHYLEEQGIEALESDLGEYIVQLADETPSHIIMPAIHKNTGEISQLLHEKTG
TDLSNDVEYLTASARLQLREKFMNADVGVSGVNFAVAETGTLCLVENEGNGRMTTTVPKC
HIAVTGIEKVVPSMEDVSALLALLTRSATGQHITTYFNMISGPRKAEELDGPEEVHLVLV
DNGRSSIYQDDELLDTLRCIRCGACMNHCPVYTRVGGHAYGTTYPGPIGKILMPHLIGLD
EGRHLPSASSLCGACGEVCPVKIPIPDLLVRLRQESVDGDKLHPAKVRGHGAKRSSMEAM
IWKGWAWMHASPGIYRFGTGAASKFRALQPSKAGAWTDYRTAPKLAAKTLHQRMKERGQ